PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun012225
Common NameVuSOC1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24431.7 Da    PI: 9.3726
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S56866847PU_refUnigeneView CDS
PUT-167a-Vigna_unguiculata-15579PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.13e-301059251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               rien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Vun012225 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS 59
               8***********************************************86 PP

2K-box88.81e-2977170497
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                ++ ++ +e+++++l+qe a+L k+ie L+ ++R+llGe+L+s+sl+eLqq+eqqLe+s++++R++Kn+++++qie+l++ke+ l  en +L ++
  Vun012225  77 QTVNRSDEQNMQHLKQETANLMKKIELLEASKRKLLGEGLGSCSLEELQQIEQQLERSVSSVRARKNQVYKDQIEQLKEKERTLYAENARLCEQ 170
                34455899*********************************************************************************99776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-33384IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.55E-43378No hitNo description
PfamPF003194.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.8E-2883170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.39187177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFASS  60
SMQETIERYR RHNRSAQTVN RSDEQNMQHL KQETANLMKK IELLEASKRK LLGEGLGSCS  120
LEELQQIEQQ LERSVSSVRA RKNQVYKDQI EQLKEKERTL YAENARLCEQ YGIQQQPGTK  180
DVRENQPYEE SSPSSEVETE LFIGLPRSTL T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-21383282Myocyte-specific enhancer factor 2A
3kov_B4e-21383282Myocyte-specific enhancer factor 2A
3kov_I4e-21383282Myocyte-specific enhancer factor 2A
3kov_J4e-21383282Myocyte-specific enhancer factor 2A
3p57_A4e-21383282Myocyte-specific enhancer factor 2A
3p57_B4e-21383282Myocyte-specific enhancer factor 2A
3p57_C4e-21383282Myocyte-specific enhancer factor 2A
3p57_D4e-21383282Myocyte-specific enhancer factor 2A
3p57_I4e-21383282Myocyte-specific enhancer factor 2A
3p57_J4e-21383282Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490257.11e-150PREDICTED: MADS-box protein SOC1-like
SwissprotO646452e-95SOC1_ARATH; MADS-box protein SOC1
TrEMBLE1CKY51e-153E1CKY5_VIGUN; Suppressor of overexpression of constans 1
STRINGGLYMA18G45780.11e-141(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-74AGAMOUS-like 20